Recombinant Human Ezrin Protein

Beta LifeScience SKU/CAT #: BLA-3420P
Recombinant Human Ezrin Protein

Recombinant Human Ezrin Protein

Beta LifeScience SKU/CAT #: BLA-3420P
Catalog No.: BLA-3420P

Product Overview

Host Species Human
Accession P15311
Synonym Villin 2 ezrin CVIL CVL Cytovillin Cytovillin 2 DKFZp762H157 Epididymis secretory protein Li 105 EZR EZRI_HUMAN Ezrin FLJ26216 HEL S 105 MGC1584 p81 VIL 2 VIL2 Villin 2 Villin 2 (ezrin) Villin-2 Villin2
Description Recombinant Human Ezrin Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYV DNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQK LFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSE RLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEM YGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISF NDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLR LQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAK EELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAK EAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQDEGAEPTGYS AELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHN DIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Molecular Weight 96 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed