Recombinant Human Ext2 Protein

Beta LifeScience SKU/CAT #: BLA-3404P
Recombinant Human Ext2 Protein

Recombinant Human Ext2 Protein

Beta LifeScience SKU/CAT #: BLA-3404P
Catalog No.: BLA-3404P

Product Overview

Host Species Human
Synonym Exostoses (multiple) 2 Exostosin 2 Exostosin-2 EXT2 EXT2_HUMAN Glucuronosyl N acetylglucosaminyl proteoglycan 4 alpha N acetylglucosaminyltransferase Glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase Multiple exostoses protein 2 N acetylglucosaminyl proteoglycan 4 beta glucuronosyltransferase Putative tumor suppressor protein EXT2 SOTV
Description Recombinant Human Ext2 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MCASVKYNIRGPALIPRMKTKHRIYYITLFSIVLLGLIATGMFQFWPHSI ESSNDWNVEKRSIRDVPVVRLPADSPIPERGDLSCRMHTCFDVYRCGFNP KNKIKVYIYALKKYVDDFGVSVSNTISREYNELLMAISDSDYYTDDINRA CLFVPSIDVLNQNTLRIKETAQAMAQLSRWDRGTNHLLFNMLPGGPPDYN TALDVPRDRALLAGGGFSTWTYRQGYDVSIPVYSPLSAEVDLPEKGPGPR QYFLLSSQVGLHPEYREDLEALQVKHGESVLVLDKCTNLSEGVLSVRKRC HKHQVFDYPQVLQEATFCVVLRGARLGQAVLSDVLQAGCVPVVIADSYIL PFSEVLDWKRASVVVPEEKMSDVYSILQSIPQRQIEEMQRQARWFWEAYF QSIKAIALATLQIINDRIYPYAAISYEEWNDPPAVKWGSVSNPLFLPLIP PQSQGFTAIVLTYDRVESLFRVITEVSKVPSLSKLLVVWNNQNKNPPEDS LWPKIRVPLKVVRTAENKLSNRFFPYDEIETEAVLAIDDDIIMLTSDELQ FGYEVWREFPDRLVGYPGRLHLWDHEMNKWKYESEWTNEVSMVLTGAAFY HKYFNYLYTYKMPGDIKNWVDAHMNCEDIAMNFLVANVTGKAVIKVTPRK KFKCPECTAIDGLSLDQTHMVERSECINKFASVFGTMPLKVVEHRADPVL YKDDFPEKLKSFPNIGSL
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed