Recombinant Human EWSR1/EWS Protein

Beta LifeScience SKU/CAT #: BLA-3398P
Recombinant Human EWSR1/EWS Protein

Recombinant Human EWSR1/EWS Protein

Beta LifeScience SKU/CAT #: BLA-3398P
Catalog No.: BLA-3398P

Product Overview

Host Species Human
Accession Q01844
Synonym bK984G1.4 bK984G1.4 Ewing sarcoma breakpoint region 1 protein Ewing sarcoma breakpoint region 1 Ewing sarcoma breakpoint region 1 protein Ewings sarcoma EWS Fli1 type 1 oncogene EWS EWS oncogene EWS RNA binding protein 1 EWS_HUMAN EWSR 1 Ewsr1 EWSR1 protein RNA binding protein EWS RNA-binding protein EWS
Description Recombinant Human EWSR1/EWS Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence SDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETG KPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNS
Molecular Weight 36 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed