Recombinant Human ETFB Protein

Beta LifeScience SKU/CAT #: BLA-3391P
Recombinant Human ETFB Protein

Recombinant Human ETFB Protein

Beta LifeScience SKU/CAT #: BLA-3391P
Catalog No.: BLA-3391P

Product Overview

Host Species Human
Accession P38117
Synonym Beta ETF Beta-ETF Electron transfer flavoprotein beta polypeptide Electron transfer flavoprotein beta subunit Electron transfer flavoprotein subunit beta Electron transferring flavoprotein beta polypeptide etfB ETFB_HUMAN FP585 MADD
Description Recombinant Human ETFB Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMAELRVLVAVKRVIDYAVKIRVKPDRTGVV TDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALA MGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDD CNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAV VTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDP PQRTAGVKVETTEDLVAKLKEIGRI
Molecular Weight 30 kDa including tags
Purity Greater than 90% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed