Recombinant Human Estrogen Receptor alpha Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-3384P
Recombinant Human Estrogen Receptor alpha Protein (His tag)

Recombinant Human Estrogen Receptor alpha Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-3384P
Catalog No.: BLA-3384P

Product Overview

Host Species Human
Accession P03372
Synonym 7*/654 isoform 7*/819 2 isoform 7*/822 isoform 8*/901 isoform 8*/941 isoform DKFZp686N23123 ER ER alpha ER-alpha Era ESR ESR1 ESR1_HUMAN ESRA Estradiol receptor Estrogen nuclear receptor alpha Estrogen receptor Estrogen receptor 1 Estrogen receptor alpha Estrogen receptor alpha 3*,4,5,6,7*/822 isoform Estrogen receptor alpha delta 3*,4,5,6,7*,8*/941 isoform Estrogen receptor alpha delta 3*,4,5,6,7*/819 2 isoform Estrogen receptor alpha delta 4 +49 isoform Estrogen receptor alpha delta 4*,5,6,7*/654 isoform Estrogen receptor alpha delta 4*,5,6,7,8*/901 isoform Estrogen receptor alpha E1 E2 1 2 Estrogen receptor alpha E1 N2 E2 1 2 ESTRR NR3A1 Nuclear receptor subfamily 3 group A member 1
Description Recombinant Human Estrogen Receptor alpha Protein (His tag) was expressed in Yeast. It is a Protein fragment
Source Yeast
AA Sequence SGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAA YEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLM LLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQ GGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFF KRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDR RGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALS LTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMIN WAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLL LDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVY TFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLL ILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGAS VEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Molecular Weight 67 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed