Recombinant Human Estrogen Receptor alpha Protein
Beta LifeScience
SKU/CAT #: BLA-3385P
Recombinant Human Estrogen Receptor alpha Protein
Beta LifeScience
SKU/CAT #: BLA-3385P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P03372 |
Synonym | 7*/654 isoform 7*/819 2 isoform 7*/822 isoform 8*/901 isoform 8*/941 isoform DKFZp686N23123 ER ER alpha ER-alpha Era ESR ESR1 ESR1_HUMAN ESRA Estradiol receptor Estrogen nuclear receptor alpha Estrogen receptor Estrogen receptor 1 Estrogen receptor alpha Estrogen receptor alpha 3*,4,5,6,7*/822 isoform Estrogen receptor alpha delta 3*,4,5,6,7*,8*/941 isoform Estrogen receptor alpha delta 3*,4,5,6,7*/819 2 isoform Estrogen receptor alpha delta 4 +49 isoform Estrogen receptor alpha delta 4*,5,6,7*/654 isoform Estrogen receptor alpha delta 4*,5,6,7,8*/901 isoform Estrogen receptor alpha E1 E2 1 2 Estrogen receptor alpha E1 N2 E2 1 2 ESTRR NR3A1 Nuclear receptor subfamily 3 group A member 1 |
Description | Recombinant Human Estrogen Receptor alpha Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPA VYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPL NSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFY RPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVW SCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGM MKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLA DRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPG KLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKS IILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQ HQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLH APTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV |
Molecular Weight | 66 kDa |
Purity | >70% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Store at -80°C. |
Target Details
Target Function | Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3.; Involved in activation of NOS3 and endothelial nitric oxide production. Isoforms lacking one or several functional domains are thought to modulate transcriptional activity by competitive ligand or DNA binding and/or heterodimerization with the full-length receptor. Binds to ERE and inhibits isoform 1. |
Subcellular Location | [Isoform 1]: Nucleus. Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side.; Nucleus. Golgi apparatus. Cell membrane. Note=Colocalizes with ZDHHC7 and ZDHHC21 in the Golgi apparatus where most probably palmitoylation occurs. Associated with the plasma membrane when palmitoylated. |
Protein Families | Nuclear hormone receptor family, NR3 subfamily |
Database References | |
Associated Diseases | Estrogen resistance (ESTRR) |
Tissue Specificity | Widely expressed. Not expressed in the pituitary gland.; [Isoform 3]: Widely expressed, however not expressed in the pituitary gland. |
Gene Functions References
- Estrogen-induced miR-191 was identified as a direct upstream regulator of DAB2 in ER-positive breast cancer cells. PMID: 29247596
- the whole-genome insights carried in this work can help fully understanding biological roles of ER1 in breast cancer. PMID: 30301189
- there was a relationship between rs2046210 and rs3803662, and the risk of developing this disease in Vietnamese women. The A allele is the risk allele for both rs2046210 (OR [95% CI] = 1.43 [1.14 - 1.78], P = 0.0015) and rs3803662 (OR [95% CI] = 1.45 [1.16 - 1.83], P = 0.001). We conclude that two polymorphisms, rs2046210 in ESR1 and rs3803662 in TNRC9, are associated with breast cancer risk in the Vietnamese population. PMID: 30078824
- that Oestrogen receptor alpha can enhance the odonto/osteogenic differentiation of stem cells from apical papilla via ERK and JNK MAPK pathways PMID: 30069950
- No association between polymorphisms in genes encoding estrogen receptors (ESR1 and ESR2) and excreted BPA levels was found in orthodontic patients after bracket bonding. PMID: 29961922
- Analysis of the genome-wide ER binding sites identified mutant ER unique recruitment mediating the allele-specific transcriptional program PMID: 29438694
- study describes RNF8 as a co-activator of ERalpha increases ERalpha stability via post-transcriptional pathway, and provides a new insight into mechanisms for RNF8 to promote cell growth of ERalpha-positive breast cancer. PMID: 28216286
- Reduced expression of ERbeta1 in female ERalpha-negative papillary thyroid carcinoma patients is associated with greater progression of the disease. PMID: 29655286
- heterogeneous distribution in deep infiltrating endometriosis PMID: 29383962
- ER-alpha36/EGFR signaling loop promotes growth of hepatocellular carcinoma cells PMID: 29481815
- This study aimed to determine the presence and localization of oestrogen receptors (ERs), progesterone receptors (PRs), and androgen receptors (ARs) in both healthy and varicose vein wall cells and their relationship with gender. PMID: 30250632
- Estrogen receptor-alpha was expressed only in women and showed a positive correlation with the amount of fungi in oral paracoccidioidomycosis, while progesterone receptor was observed in both genders and exhibited no correlation with estrogen receptor-alpha or fungi counting. PMID: 29796757
- ERalpha upregulates vinculin expression in breast cancer cells; Loss of vinculin promotes amoeboid features of cancer cells PMID: 28266545
- polymorphisms do not predict in vitro fertilization outcome PMID: 29916276
- High ESR1 expression is associated with metastasis in breast Cancer. PMID: 29187405
- The G/G XbaI genotype of ESR1 gene is associated with breast cancer risk. PMID: 29893332
- miR-221 may impair the protective effect of estrogen in degenerated cartilaginous endplate cells through targeting estrogen receptor alpha PMID: 29529124
- Results showed that NAT1 and ESR1 expression were increased in primary breast tumor samples compared with normal breast tissue samples, and in ER+ primary breast tumors compared with ER- tumors. Also, NAT1 and ESR1 expression seems to have overlapping regulation. PMID: 29901116
- all the patients without these mutations by molecular barcode next-generation sequencing (MB-NGS) were found to have no mutations by ddPCR. In conclusion, MB-NGS could successfully detect ESR1 mutations in cfDNA with a higher sensitivity of 0.1% than conventional NGS and was considered as clinically useful as ddPCR PMID: 28905136
- In summary, an association between the presence of the particular genotypes at the three ESR1 polymorphisms (rs2234693, rs6902771, rs7774230) and one ESR2 polymorphism (rs3020449), and the presence of metabolic syndrome in postmenopausal women was found. PMID: 30049354
- higher frequency of ESR1 and PIK3CA mutations in the plasma than in the serum in 33 MBC patients; therefore, serum samples should not be considered the preferred source of cfDNA. PMID: 29689710
- These results suggest that miR-125a-3p can function as a novel tumor suppressor in ER(+) breast cancer by targeting CDK3, which may be a potential therapeutic approach for TamR breast cancer therapy PMID: 28939591
- A major finding of our study is that one out of five (20%) patients with breast cancer BM had a receptor discrepancy between the primary tumor and the subsequent BM, with loss of hormone receptors (ER and/or PR) expression, and gain of HER2 overexpression as the most commonly observed changes PMID: 28975433
- Here the authors report a nodal role of IGF-IR in the regulation of ERalpha-positive breast cancer cell aggressiveness and the regulation of expression levels of several extracellular matrix molecules. PMID: 28079144
- The associations between PvuII (T>C) and XbaI (A>G) polymorphisms of estrogen receptor alpha (ESR1) gene with type 2 diabetes mellitus (T2DM) or metabolic syndrome (MetS), are reported. PMID: 29883973
- The ERalpha gene seems to play a key role in stress urinary incontinence in the premenopausal period. PMID: 29769420
- Study reports the first discovery of naturally occurring ESR1 (Y537C) and ESR1 (Y537S) mutations in MCF7 and SUM44 ESR1-positive cell lines after acquisition of resistance to long-term-estrogen-deprivation (LTED) and subsequent resistance to fulvestrant (ICIR). Mutations were enriched with time, impacted on ESR1 binding to the genome and altered the ESR1 interactome. PMID: 29192207
- Concomitant high expression of ERalpha36, GRP78 and GRP94 is associated with aggressive papillary thyroid cancer behavior and may be used as a predictor for extrathyroid extension, lymph node metastasis, and distant metastasis. PMID: 29368272
- Estrogen receptor-1 is a key regulator of HIV-1 latency that imparts gender-specific restrictions on the latent reservoir. PMID: 30061382
- Down-regulation of ESR1 gene expression was enhanced by the development of the breast cancer. PMID: 29543921
- The aim of the present study was to assess whether fibrosis markers, estrogen receptor (ER)alpha and the stromal derived factor (SDF)1/CXC chemokine receptor type 4 (CXCR4) axis are abnormally expressed in Intrauterine adhesions endometrium. PMID: 29568895
- The frequency of alleles and genotypes of polymorphisms FSHR(-29G/A) and ESRI (XbaI A/G) in women with normal to poor response did not have significant correlation. PMID: 29526845
- Each estrogen receptor alpha and estrogen receptor beta gene polymorphism might have different impact on postmenopausal osteoporosis risk and bone mineral density in various ethnicities. PMID: 29458346
- The results suggest that minor allele A of ESR1 gene is associated with the development of arterial hypertension in men. PMID: 29658078
- Study found that tamoxifen treatment induced a decrease in PRMT2 and an increase in ER-alpha36 as well as ER-alpha36-mediated non-genomic effect in MDA-MB-231 breast cancer cell line. PMID: 29620287
- ESR1 mutations are not associated with clinical resistance to fulvestrant in breast cancer patients. PMID: 27174596
- verexpression of COPS5, through its isopeptidase activity, leads to ubiquitination and proteasome-mediated degradation of NCoR, a key corepressor for ERalpha and tamoxifen-mediated suppression of ERalpha target genes. PMID: 27375289
- ESR alpha PvuII and XbaI polymorphisms have no association with ; systemic lupus erythematosus. The combination of the TC/AA and CC/GG genotypes were associated with SLE susceptibility. PMID: 29356461
- Estrogen receptor (ER) and progesterone receptor (PR) expression in endometrial carcinoma (EC) were significantly higher than those in the paracarcinoma tissue and control. PMID: 29081408
- ESR1 promoter methylation was an independent risk factor and had a high value to predict 28-day mortality from acute-on-chronic hepatitis B liver failure PMID: 29082740
- by analyzing different estrogen receptor-alpha(ER-a)-positive and ER-a-negative breast cancer cell lines, we defined the role of CCN5 in the leptin-mediated regulation of growth and invasive capacity. PMID: 29370782
- This study identified ESR1 as a direct target of miR-301a-3p. PMID: 29763890
- Authors report for the first time the presence of ESR1 methylation in plasma ctDNA of patients with HGSC. The agreement between ESR1 methylation in primary tumors and paired ctDNA is statistically significant. PMID: 29807696
- this study reports the development of a novel class of ERa AF2 inhibitors, which have the potential to effectively inhibit ERa activity by a unique mechanism and to circumvent the issue of mutation-driven resistance in breast cancer PMID: 29462880
- the P2X7R rs3751143 and ER-alpha PvuII two-locus interaction confers a significantly high susceptibility to osteoporosis in Chinese postmenopausal women. PMID: 28884379
- Alcohol consumption may have differential effects on concordant and discordant receptor subtypes of breast cancer. PMID: 29353824
- ERalpha and ERbeta mRNA expression was significantly higher (p < 0.05) in tumour tissues relative to their paired normal mucosa and correlated inversely with survival outcome PMID: 29390981
- High ESR1 expression is associated with Papillary Thyroid Carcinoma. PMID: 28124274
- Oral administration of RAD140 substantially inhibited the growth of AR/ER(+) breast cancer patient-derived xenografts (PDX). Activation of AR and suppression of ER pathway, including the ESR1 gene, were seen with RAD140 treatment. PMID: 28974548
- Polymorphism in the ERalpha gene is associated with an increased risk for advanced Pelvic Organ Prolapse. However, polymorphism in the LAMC1 gene does not seem to be associated with such risk. PMID: 29241914