Recombinant Human ERp72 Protein

Beta LifeScience SKU/CAT #: BLA-3370P
Recombinant Human ERp72 Protein

Recombinant Human ERp72 Protein

Beta LifeScience SKU/CAT #: BLA-3370P
Catalog No.: BLA-3370P

Product Overview

Host Species Human
Accession P13667
Synonym Calcium binding protein intestinal related Endoplasmic reticulum resident protein 70 Endoplasmic reticulum resident protein 72 EPR70 EPR72 ER protein 70 ER protein 72 ERP 70 ERp 72 ERp-72 ERp70 ERp72 PDIA 4 Pdia4 PDIA4_HUMAN PDIR Protein disulfide isomerase A4 Protein disulfide isomerase associated 4 Protein disulfide isomerase family A member 4 Protein disulfide isomerase related protein protein disulfide isomerase related protein (calcium-binding protein, intestinal-related) Protein disulfide-isomerase A4 Protein ERp 72 Protein ERp72
Description Recombinant Human ERp72 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMVAGAEGPDEDSSNRENAIEDEEEEEEEDD DEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAP EYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAV DYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILV EFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDV SGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEF LKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLK VSQGQLVVMQPEKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGH RKVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPEYT FAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEPEEFDSDTLR EFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIE FYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEG FPTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATKLSRTKEEL
Molecular Weight 73 kDa including tags
Purity >90% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Specific activity > 10 A650/cm/min/mg. Enzymatic activitywas confirmed by measuring the aggregation of insulin in the presence of DTT.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed