Recombinant Human ERK1 Protein

Beta LifeScience SKU/CAT #: BLA-3350P
Recombinant Human ERK1 Protein

Recombinant Human ERK1 Protein

Beta LifeScience SKU/CAT #: BLA-3350P
Catalog No.: BLA-3350P

Product Overview

Host Species Human
Accession P27361
Synonym ERK 1 ERK-1 ERK1 ERT 2 ERT2 Extracellular Signal Regulated Kinase 1 Extracellular signal related kinase 1 Extracellular signal-regulated kinase 1 HGNC6877 HS44KDAP HUMKER1A Insulin Stimulated MAP2 Kinase Insulin-stimulated MAP2 kinase MAP Kinase MAP kinase 1 MAP kinase 3 MAP kinase isoform p44 MAPK MAPK 1 MAPK 3 MAPK1 Mapk3 MGC20180 Microtubule Associated Protein 2 Kinase Microtubule-associated protein 2 kinase Mitogen Activated Protein Kinase 3 Mitogen-activated protein kinase 1 Mitogen-activated protein kinase 3 MK03_HUMAN OTTHUMP00000174538 OTTHUMP00000174541 p44 ERK1 p44 MAPK p44-ERK1 p44-MAPK P44ERK1 P44MAPK PRKM 3 PRKM3 Protein Kinase Mitogen Activated 3
Description Recombinant Human ERK1 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSAAAAAQGGGGGEPRRTEGV GPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAI KKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPS NLLSNTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSK GYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLN CIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRIT VEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETAR FQPGVLEAP
Molecular Weight 70 kDa including tags
Purity >80% Proprietary Purification.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Specific activity: 379.25 units/ml; 621.73 Units/mg
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed