Recombinant Human ERH Protein

Beta LifeScience SKU/CAT #: BLA-3348P
Recombinant Human ERH Protein

Recombinant Human ERH Protein

Beta LifeScience SKU/CAT #: BLA-3348P
Catalog No.: BLA-3348P

Product Overview

Host Species Human
Accession P84090
Synonym DROER Enhancer of rudimentary homolog Enhancer of rudimentary homolog (Drosophila) ERH ERH_HUMAN FLJ27340 HGNC:3447
Description Recombinant Human ERH Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSMSHTILLVQPTKRPEGRTYADYESVNE CMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQ TYQPYNKDWIKEKIYVLLRRQAQQAGK
Molecular Weight 15 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle.
Recently viewed