Recombinant Human ERG Protein

Beta LifeScience SKU/CAT #: BLA-3346P
Recombinant Human ERG Protein

Recombinant Human ERG Protein

Beta LifeScience SKU/CAT #: BLA-3346P
Catalog No.: BLA-3346P

Product Overview

Host Species Human
Accession P11308-4
Synonym Avian erythroblastosis virus E-26 (v-ets) oncogene related D030036I24Rik Erg Erg 3 ERG/EWS fusion gene, included ERG/FUS fusion gene, included ERG/TMPSSR2 fusion gene, included ERG_HUMAN ERG1, included ERG2, included ets related ETS-related gene KCNH2 Oncogene ERG p55 TMPRSS2/ERG fusion Transcriptional regulator ERG transcriptional regulator ERG (transforming protein ERG) Transforming protein ERG v ets avian erythroblastosis virus E26 oncogene v ets avian erythroblastosis virus E26 oncogene related v ets erythroblastosis virus E26 oncogene homolog v ets erythroblastosis virus E26 oncogene like v ets erythroblastosis virus E26 oncogene like isoform 2 v-ets erythroblastosis virus E26 oncogene v-ets erythroblastosis virus E26 oncogene homolog (avian) V-ets erythroblastosis virus E26 oncogene like (Avian), isoform CRA_e
Description Recombinant Human ERG Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MASMTGGQQMGRGHHHHHHENLYFQGSASTIKEALSVVSEDQSLFECAYG TPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQ VNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERR VIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKD DFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNT GGAAFIFPNTSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQ PSPSTVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDS SNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYD KNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAH PQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSH LGTYYLEESGGGGSPGRRRRRRRRRRR
Molecular Weight 59 kDa including tags
Purity Greater than 90% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Recently viewed