Recombinant Human Collagen alpha-1 (COL11A1) Protein (GST)

Name: Recombinant Human Collagen alpha-1 (COL11A1) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-05292P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Collagen alpha-1 (COL11A1) Protein (GST) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P12107
Target Symbol	COL11A1
Synonyms	COBA1_HUMAN; COL11A1; COLL6; Collagen alpha 1; Collagen alpha-1(XI) chain; collagen XI alpha 1; collagen XI; alpha 1 polypeptide ; collagen; type XI; alpha 1; STL2; STL3; XI chain precursor
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-GST
Target Protein Sequence	GPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQ
Expression Range	532-699aa
Protein Length	Partial
Mol. Weight	42.8kDa
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May play an important role in fibrillogenesis by controlling lateral growth of collagen II fibrils.
Subcellular Location	Secreted, extracellular space, extracellular matrix.
Protein Families	Fibrillar collagen family
Database References	HGNC: 2186 OMIM: 120280 KEGG: hsa:1301 STRING: 9606.ENSP00000359114 UniGene: Hs.523446
Associated Diseases	Stickler syndrome 2 (STL2); Marshall syndrome (MRSHS); Fibrochondrogenesis 1 (FBCG1)
Tissue Specificity	Cartilage, placenta and some tumor or virally transformed cell lines. Isoforms using exon IIA or IIB are found in the cartilage while isoforms using only exon IIB are found in the tendon.

Gene Functions References

results suggested that common polymorphisms in these two candidate genes were unlikely to play major roles in the genetic susceptibility to HM. Nevertheless, to avoid filtering real myopia genes, the role of COL11A1 and COL18A1 in the pathogenesis of myopia requires more refinement in both animal models and human genetic epidemiological studies PMID: 29781737
These results showed that the frequency distribution of genotypes of the rs2229783 polymorphism in COL11A1 was significantly different between the Kashin-Beck Disease (KBD) and control groups; the expression level of COL11A in cartilage was significantly lower in the KBD group, but no association was found between the rs2229783 and the severity of KBD. PMID: 29773097
We confirmed that the rs1676486 of COL11A may be functionally associated with lumbar disc herniation (LDH) in the Chinese population. Extracellular matrix related proteins may play an important role in the pathogenesis of LDH. Our findings shed light on a better understanding of the pathogenesis of LDH, which could be a promising target for a novel treatment modality of LDH. PMID: 29321344
Study found one gene significantly associated when looking for associations between multiple common and rare variants with pneumococcal meningitis susceptibility, namely the COL11A1 gene. PMID: 27389768
The SNPs rs1337185 in COL11A1 and rs162509 in ADAMTS5 are associated with susceptibility to lumbar disc degeneration. The C allele of rs1337185 is risky for patients who are affected by lumbar pathologies such as disc herniation, stenosis and spondylolisthesis. The G allele of rs16250 represents a risk factor for the development of disc herniation. PMID: 28583914
Chondrogenic potential was higher and Wnt/beta-catenin signaling was more potently activated by a GSK-3beta inhibitor in the posterior than in the anterior part of the human infant sclera. PMID: 27336854
genetic variants of COL11A1 contribute to adult height in Chinese Han population but not to children height PMID: 27614704
proCOL11A1, fibroblast-activated protein, secreted protein acidic and rich in cysteine, and periostin expression was significantly increased in the intratumoral stroma of pancreatic ductal adenocarcinomas compared to paired non-neoplastic pancreata PMID: 29025374
we demonstrate how COL11A1 regulates twist family basic helix-loop-helix transcription factor 1-related protein 1 (TWIST1) to induce chemoresistance and inhibit apoptosis in ovarian cancer cells PMID: 28815582
the racial differences of COL11A1 were consistent across multiple molecular levels, with higher mutation frequency, higher methylation, and lower expression in White patients. This indicated that COL11A1 might play important roles in ESCC, especially in White population. Additional studies are needed to further explore their functions in esophageal cancer PMID: 28393072
Investigated genetic variants in COL11A1 predisposing to primary hip OA in Han Chinese individuals.Two SNPs (rs1241164 and rs4907986) were found to be significantly associated with hip OA risk (adjusted p = 0.000731 and 0.000477). An increased risk of OA was associated with possession of the C allele of rs1241164 and the T allele of rs4907986. PMID: 27936936
COL11A1 antibody can assist in distinguishing the cancer-associated desmoplastic stroma from that associated with misplaced adenomatous mucosa. It is particularly helpful when electrocautery artifacts or mucin pools interfere with the diagnosis of invasive carcinoma. However, COL11A1 has limited value in diagnosing superfically invasive carcinomas with very little desmoplastic stroma. PMID: 27021528
COL11A1 is overexpressed in gastric cancer tissues and regulates cell proliferation and migration. PMID: 28004111
COL11A1 may sever as a biomarker for metastatic NSCLC. PMID: 27373316
Familial linkage studies for primary angle-closure glaucoma have been performed and identified MYOC causative primary angle-open-glaucoma disease PMID: 26497787
No significant association of PLEKHA7 rs11024102, COL11A1 rs3753841 and PCMTD1-ST18 rs1015213 with primary angle closure glaucoma was found among ethnic Han Chinese from Sichuan PMID: 27455018
Analysis of 104 epithelial ovarian carcinoma patients showed that high COL11A1 mRNA levels are significantly associated with poor chemoresponse and clinical outcome. PMID: 26087191
These data suggest that pro-COL11A1 expression is a highly sensitive biomarker to predict malignant relapse of intraductal papilloma. PMID: 26448946
This meta-analysis suggests that PLEKHA7 rs11024102 is associated with PACG (primary angle closure glaucoma) in Asian population and COL11A1 rs3753841 has a genetic association with the development of PACG both in Caucasian and Asian populations. PMID: 25732101
High Col11A1 mRNA expression is associated with Adenocarcinoma of the Papilla of Vater and Pancreas Carcinoma. PMID: 26504042
Expanded spectrum of mutations in the COL11A1 and COL11A2 genes in Stickler syndrome. PMID: 25240749
COL11A1 expression is a promising marker of invasive breast lesions, and may be included in immunohistochemical panels aiming at identifying infiltration in problematic breast lesions. PMID: 25175819
The immunodetection of procollagen 11A1 in cancer-associated stromal cells could be a useful biomarker for human colon adenocarcinoma characterisation. PMID: 25417197
COL11A1/(pro)collagen 11A1 expression is a remarkable biomarker of human carcinoma-associated stromal cells and carcinoma progression. PMID: 25761876
These cases highlight both a novel dominant COL11A1 mutation causing a significant skeletal dysplasia. PMID: 25091507
Studies indicate that collagen type XI alpha 1 (colXIalpha1) is overexpressed at mRNA and protein levels in many cancer types. PMID: 25511741
proCOL11A1 is a specific marker for pancreatic cancer-associated fibroblasts, and thus, anti-proCOL11A1 is a powerful new tool for cancer research and clinical diagnostics. PMID: 24194920
The study demonstrates that some mutations in COL11A1 are recessive, modified by alternative splicing and result in type 2 Stickler syndrome rather than fibrochondrogenesis. PMID: 23922384
COL11A1 may promote tumor aggressiveness via the TGF-beta1-MMP3 axis and COL11A1 expression can predict clinical outcome in ovarian cancer patients. PMID: 23934190
Our study suggests that rs1676486 and rs12138977 in COL11A1 as well as rs216489 and rs11024102 in PLEKHA7 are associated with an increased risk of PAC/PACG in the Han Chinese population PMID: 24854855
Some studies have shown the association between gene COL11A1 polymorphism c.4603C>T and intervertebral disc disease--{review} PMID: 24636772
The three genetic susceptibility loci for primary angle-closure glaucoma did not underlie any major phenotypic diversity in terms of disease severity or progression. PMID: 24474268
Axial length, anterior chamber depth and keratometry were not associated with rs3753841 or rs11024102 genotypes including after adjusting for age and sex. PMID: 23505305
COL11A1 allelic imbalance is common in osteoarthritis but is not a risk factor for osteoarthritis. PMID: 23497244
a TT genotype of COL11A1 polymorphism may be a significant risk factor for limbus vertebra in Japanese collegiate gymnasts. PMID: 22510797
our data shall improve the overall understanding of fibrochondrogenesis especially in surviving homozygous patients and, at least partly, explain the phenotypic variability associated with COL11A1 gene mutations. PMID: 21668896
study reports the first evidence that adds COL11A1 defect as a cause of Marshall syndrome with a recessive mode of inheritance PMID: 22499343
variants detected in COL11A1 in patients with Stickler syndrome PMID: 22189268
Characterize mouse monoclonal antibody specific for human procollagen 11A1 and report its use for immunohistochemistry in human breast tumor tissue. PMID: 22322826
Common polymorphisms in four candidate genes (COL11A1, COL18A1, FBN1 and PLOD1) were unlikely to play important roles in the genetic susceptibility to high myopia. PMID: 21527992
These findings identify COL11A1 as a locus for fibrochondrogenesis and indicate that there might be phenotypic manifestations among carriers. PMID: 21035103
Study identified 57 novel mutations including missense changes in both COL2A1 and COL11A1. PMID: 20513134
A statistically significant difference has been found in COL11A1 expression between normal tissue and adenomas from a familial adenomatous polyposis patient, and all adenomas give evidence of an active adenomatous polyposis coli/beta-catenin pathway. PMID: 11707154
sequence variations in these genes can play a role in the etiology of Robin sequence, cleft palate and micrognathia but are not common causes of these phenotypes. PMID: 12673280
CBF/NF-Y proteins regulate the transcription of COL11A1 by directly binding to the ATTGG sequence in the proximal promoter region PMID: 12805369
Six pedigrees with type 2 Stickler syndrome with mutations in COL11A1. PMID: 15286167
Heterozygous COL11A1 mutations were found in 10 individuals with Stickler or Marshall syndromes. PMID: 17236192
Type XI collagen is critical for intervertbral dis metabolism and its decrease is related to lumbar disc herniation. PMID: 17999364
This study is the first to show that collagen XI is present in the Golgi apparatus of normal human colon goblet cells and localizes collagen XI in both normal and malignant tissue. PMID: 18040076
The data above suggest that focal adhesion pathway may have a role in the pathogenesis of gastric cancer, and the expression profile of collagen genes may be a potential biomarker to distinguish malignant from premalignant lesions in stomach PMID: 19306436

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.