Recombinant Human ART5 Protein
Beta LifeScience
SKU/CAT #: BLA-12245P
Recombinant Human ART5 Protein
Beta LifeScience
SKU/CAT #: BLA-12245P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | ADP ribosyltransferase 5 ADP-ribosyltransferase C2 and C3 toxin-like 5 ART 5 ART5 ARTC5 EC 2.4.2.31 Ecto ADP ribosyltransferase 5 Ecto-ADP-ribosyltransferase 5 MGC22848 Mono (ADP ribosyl) transferase 5 Mono(ADP-ribosyl)transferase 5 NAD(P)(+) arginine ADP ribosyltransferase 5 NAD(P)(+)--arginine ADP-ribosyltransferase 5 NAR5_HUMAN |
Description | Recombinant Human ART5 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MALAALMIALGSLGLHTWQAQAVPTILPLGLAPDTFDDTYVGCVEEMEEK AAPLLKEEMAHHALLRESWEAAQETWEDKRRGLTLPPGFKAQNGIAIMVY TNSSNTLYWELNQAVRTGGGSRELYMRHFPFKALHFYLIRALQLLRGSGG CSRGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATL FSLTTCFGAPIQAFSVFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSY NQTCSHFNCAYLGGEKRRGCVSAPGALGTGDLHMTKRHLQQP |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |