Recombinant Human ARMS2 Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-12233P
Recombinant Human ARMS2 Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-12233P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P0C7Q2 |
Synonym | Age related maculopathy susceptibility 2 Age related maculopathy susceptibility protein 2 mitochondrial ARMD8 ARMS2 ARMS2 age related maculopathy susceptibility 2 LOC387715 Macular degeneration age related 8 |
Description | Recombinant Human ARMS2 Protein (denatured) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMLRLYPGPMVTEAEGKGGPEMASLSSS VVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAKIHTELCL PAFFSPAGTQRRFQQPQHHLTLSIIHTAAR |
Molecular Weight | 14 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |