Recombinant Human ARL5A Protein
Beta LifeScience
SKU/CAT #: BLA-12227P
Recombinant Human ARL5A Protein
Beta LifeScience
SKU/CAT #: BLA-12227P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9Y689 |
Synonym | ADP ribosylation factor like 5 ADP ribosylation factor like 5A ADP ribosylation factor like protein 5 ADP ribosylation factor like protein 5A ARFLP 5 ARFLP5 ARL 5 ARL 5A ARL5 |
Description | Recombinant Human ARL5A Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMGILFTRIWRLFNHQEHKVIIVGLDN AGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSS WNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANK QDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRL KIR |
Molecular Weight | 23 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |