Recombinant Human ARL4D Protein
Beta LifeScience
SKU/CAT #: BLA-12226P
Recombinant Human ARL4D Protein
Beta LifeScience
SKU/CAT #: BLA-12226P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P49703 |
Synonym | ADP ribosylation factor 4 like ADP ribosylation factor like 4D ADP ribosylation factor like 6 ADP ribosylation factor like protein 4D ADP ribosylation factor like protein 4L ADP-ribosylation factor-like protein 4D ADP-ribosylation factor-like protein 4L AR L6 ARF 4L ARF4L ARL 4D ARL 6 ARL4D ARL4D_HUMAN ARL6 |
Description | Recombinant Human ARL4D Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGNHLTEMAPTASSFLPHFQALHVVVIGLD SAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVG GQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQ GVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGL QQGLERLYEMILKRKKAARGGKKRR |
Molecular Weight | 24 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |