Recombinant Human ARL4C Protein
Beta LifeScience
SKU/CAT #: BLA-12225P
Recombinant Human ARL4C Protein
Beta LifeScience
SKU/CAT #: BLA-12225P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | ADP ribosylation factor like 4C ADP ribosylation factor like 7 ADP-ribosylation factor-like protein 4C ADP-ribosylation factor-like protein 7 ADP-ribosylation factor-like protein LAK Arl4c ARL4C_HUMAN ARL7 LAK |
Description | Recombinant Human ARL4C Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTE KIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDR LEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELI PATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |