Recombinant Human ARL15 Protein
Beta LifeScience
SKU/CAT #: BLA-12220P
Recombinant Human ARL15 Protein
Beta LifeScience
SKU/CAT #: BLA-12220P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9NXU5 |
Synonym | A430036I03 ADP ribosylation factor like 15 ADP ribosylation factor like GTPase 15 ADP-ribosylation factor-like protein 15 ADP-ribosylation factor-related protein 2 ARF-related protein 2 ARFRP2 ARL15 ARL15_HUMAN C230032K13Rik FLJ20051 rCG_44824 |
Description | Recombinant Human ARL15 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMSDLRITEAFLYMDYLCFRALCCKGPPPAR PEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNV KELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHP QLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDM DALKDSFSQLINLLEEKDHEAVRM |
Molecular Weight | 25 kDa including tags |
Purity | Greater than 85% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |