Recombinant Human ARF6 Protein

Beta LifeScience SKU/CAT #: BLA-12199P

Recombinant Human ARF6 Protein

Beta LifeScience SKU/CAT #: BLA-12199P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession P62330
Synonym ADP ribosylation factor 6 ADP ribosylation factor protein 6 ADP-ribosylation factor 6 ARF6 ARF6_HUMAN DKFZp564M0264 Small GTP binding protein Small GTPase
Description Recombinant Human ARF6 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGKVLSKIFGNKEMRILMLGLDAAGKTTIL YKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTG TQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAM KPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
Molecular Weight 22 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function GTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton remodeling. Required for normal completion of mitotic cytokinesis. Plays a role in the reorganization of the actin cytoskeleton and the formation of stress fibers. Involved in the regulation of dendritic spine development, contributing to the regulation of dendritic branching and filopodia extension. Plays an important role in membrane trafficking, during junctional remodeling and epithelial polarization. Regulates surface levels of adherens junction proteins such as CDH1. Required for NTRK1 sorting to the recycling pathway from early endosomes.; (Microbial infection) Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase.
Subcellular Location Cytoplasm, cytosol. Cell membrane; Lipid-anchor. Endosome membrane; Lipid-anchor. Recycling endosome membrane; Lipid-anchor. Cell projection, filopodium membrane; Lipid-anchor. Cell projection, ruffle. Cleavage furrow. Midbody, Midbody ring. Early endosome membrane; Lipid-anchor. Golgi apparatus, trans-Golgi network membrane; Lipid-anchor.
Protein Families Small GTPase superfamily, Arf family
Database References
Tissue Specificity Ubiquitous, with higher levels in heart, substantia nigra, and kidney.

Gene Functions References

  1. Data show that the ADP-ribosylation factor 6 (Arf6)-trafficking kinesin protein 1 (trak1) promote the anterograde trafficking of mitochondria. PMID: 29992963
  2. Structural dynamics control allosteric activation of Grp1 and ARF6. PMID: 29276036
  3. Arf6 appears to be necessary for both RhoA- and Rac1-driven cancer invasion PMID: 27754741
  4. By means of reducing the expression of Arf6 and subsequent signal transduction via NF-kappaB, miR-145 plays a role in inhibiting the secretion of inflammatory factors and then improving the inflammatory status. PMID: 29388044
  5. In Jurkat cells, the activities of two guanine nucleotide binding proteins, Arf6 and Rab22 (also known as Rab22a), influence CIE and conjugate formation. PMID: 28584192
  6. The Arf6 is of particular interest,since it is believed to play a regulatory role in several cellular physiological functions, including cell-cell interactions(adhesiveness), motility, shape maintenance, and responses to environmental stimuli via cytoskeletal adaptations and vesicular trafficking. PMID: 29119258
  7. computational study suggests that although curcumin to some extent binds with Tp receptor, yet the inhibition of Arf6GDP to Arf6GTP conversion appeared to be an important mechanism by which curcumin inhibits U46619-induced increase in PLD activity in PASMCs. PMID: 28780751
  8. This study identifies a novel regulatory crosstalk between Ral and Arf6 that controls Ral function in cells. PMID: 27269287
  9. ARHGAP24 may regulate pseudopod formation downstream of activated ARF6 in MDA-MB-231 human breast carcinoma cells. PMID: 28870903
  10. ARF6 was a downstream target of Kras/ERK signaling pathway, and the strong correlation of expression between Kras and ARF6 in the TCGA dataset further confirmed this observation. PMID: 28025100
  11. FRMD4A RNAi or inhibition of cytohesins strongly upregulated secretion of endogenous tau. These results suggest that FRMD4A, a genetic risk factor for late-onset Alzheimer's disease, regulates tau secretion by activating cytohesin-Arf6 signaling. PMID: 27044754
  12. Macrophage tissue factor prothrombotic activity is regulated by integrin-alpha4/arf6 trafficking. PMID: 28495929
  13. Here the authors report that EspG interacts specifically with the small GTPases ARF6 and Rab35 during infection. PMID: 27261256
  14. These results identify RalF as the first bacterial effector to directly activate Arf6, a process that initiates alterations in phosphoinositol metabolism critical for a lineage-specific Rickettsia entry mechanism. PMID: 27698019
  15. Data suggest that activated ARF6 controls GNAQ and b-catenin signaling by regulating protein trafficking between intracellular compartments. Blocking ARF6 with a small-molecule inhibitor reduces uveal melanoma cell proliferation and tumorigenesis in a mouse model. PMID: 27265506
  16. expression and activation of LHCGR and ARF6 are up-regulated in GC from PCOS women but the mechanism of agonist-induced LHCGR internalization is unaltered PMID: 27061682
  17. The Squamous cell carcinoma of the tongue cell line SCC-9, which overexpress Arf6 and AMAP1, also expressed EPB41L5 at high levels to promote invasiveness, whereas the weakly invasive SCC-25 cells did not express EPB41L5 at notable levels. PMID: 27871329
  18. both Arf6 activation through GluN2B-BRAG1 during early development and the transition from BRAG1- to BRAG2-dependent Arf6 signaling induced by the GluN2 subunit switch are critical for the development of mature glutamatergic synapses. PMID: 26884337
  19. results provide evidence for a novel Arf6 activation mechanism by Dyn2 through EFA6B and EFA6D in CME in a manner dependent upon the GTPase activity of Dyn2 PMID: 26503427
  20. Mutant p53, which is known to support tumorigenesis via MVP, promotes Arf6 activation. PMID: 27044891
  21. The expression of miR-206 by HUVECs reduced exosome production by regulating ADP-Ribosylation Factor 6 (ARF6) and sodium/calcium exchanger 1 (NCX1). PMID: 27031991
  22. The role of EGFR-ARF6 signaling in BA. PMID: 26379158
  23. Data suggest ADAP2 (an interferon-beta stimulated gene) disrupts pathogenic internalization of some RNA viruses/virions (dengue, vesicular stomatitis) by altering ADP ribosylation factor 6-mediated processes including up-regulation of pinocytosis. PMID: 26372645
  24. Results show that miR-145 directly targets the 3'UTR of ARF6 mRNA; its expression is upregulated in triple-negative breast cancer and tumor metastasis. PMID: 25253741
  25. The authors show that Shigella flexneri IpgD phosphatase activity is required for recruitment of the ARF6 guanine nucleotide exchange factor (GEF) ARF nucleotide binding site opener (ARNO) to bacterial entry sites. PMID: 25736891
  26. a role for ARF6 in linking EGF-receptor signaling to Rac1 recruitment and activation at the plasma membrane to promote breast cancer cell directed migration PMID: 25799492
  27. Wnt5a is a potential suppressor of EMT; there is a novel Arf6/ERK signaling pathway for EGF-regulated Wnt5a expression at transcriptional level of gastric cancer cel PMID: 25779663
  28. Data indicate that exocytic stimuli promote ADP ribosylation factor 6 (ARF6) activation, which accomplishes exocytosis by stimulating Rab3A GTP-Binding Protein. PMID: 25713146
  29. Formation of the ventral actin structures was enhanced by expression of active forms of either Arf1 or Arf6 and by the expression of guanine nucleotide exchange factors that activate these Arfs. PMID: 24916416
  30. Arf6 guanine nucleotide exchange factor cytohesin-2 binds to CCDC120 and is transported along neurites to mediate neurite growth. PMID: 25326380
  31. EFA6R regulated ARF6 localization and thereby actin stress fiber loss. PMID: 25296758
  32. Cytohesin-2 constitutively suppresses platelet dense granule secretion and aggregation by keeping ARF6 in a GTP-bound state PMID: 24581425
  33. Syntenin-ALIX exosome biogenesis and budding into multivesicular bodies are controlled by ARF6 and PLD2. PMID: 24637612
  34. 8 GEFs control Arf6 activation.[review] PMID: 24139303
  35. The EGFR-GEP100-Arf6 axis affected the prognosis of patients with primary lung adenocarcinoma. PMID: 24902879
  36. hERG undergoes clathrin-independent endocytosis via a mechanism involving Arf6 PMID: 24392021
  37. MyD88-ARNO-ARF6-signaling axis is responsible for LPS-induced endothelial permeability and is a destabilizing convergence point used by multiple inflammatory cues PMID: 24835390
  38. Data indicate that tumor necrosis factor-alpha (TNF) abolishes nuclear localization of IL-15 and IL-15Ralpha by acting on chromosomal region maintenance 1 (CRM1), and it facilitates exocytosis of IL-15 with the involvement of ADP-ribosylation factor 6 (ARF6). PMID: 23950892
  39. SMAP1 loss-of-function mutations in microsatellite instability colorectal cancer may contribute to the emerging oncogenic pathway involving abnormal Arf6 regulation. PMID: 23752192
  40. FilGAP may function as a mediator of the regulation of Rac by Arf6. PMID: 24526684
  41. The CYTH2 and ACTN1 properly regulates neurite extension in N1E-115 cells, demonstrating the unexpected interaction of CYTH2 and ACTN1 in the regulation of cellular Arf6 activity involved in neurite extension. PMID: 22659138
  42. This study reconstitutes Arf6-dependent actin assembly to reveal a mechanism by which related Arf GTPases orchestrate distinct steps in the WRC cytoskeleton remodelling pathway. PMID: 24085844
  43. mutual regulation with Rab35 of cell adhesion and migration PMID: 23264734
  44. The results thus show that ARF6 regulates neuronal differentiation through an effect on glucosylceramide synthase and glucosylceramide levels. PMID: 23555901
  45. ARF6 may provide a means of inhibiting WNT/beta-catenin signaling in cancer PMID: 23462101
  46. EFA6 participates in activation of Arf6 around the cleavage furrow during cytokinesis. PMID: 23603394
  47. Our studies implicate the small regulatory GTPase Arf6 in the endocytic trafficking of Pasteurella multocida toxin. PMID: 22053287
  48. Arf6/ ARNO signaling mediates phospholipase-D, ERK1/2 and cofilin activation in pancreatic beta-cells. PMID: 23095975
  49. ARAP2 signals through Arf6 and Rac1 to control focal adhesion morphology PMID: 23295182
  50. GRASP regulates the non-clathrin/Arf6-dependent, plasma membrane recycling and signalling pathways. PMID: 22931251

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from Other Recombinant Proteins
Greater than 90% as determined by SDS-PAGE.
Recombinant Juniperus Ashei Pectate Lyase 1
  • Molecule: Pectate Lyase 1;
  • Species: Juniperus ashei ;
  • Expression system: Yeast;
  • Tag: Tag-Free;
  • Sequence: Full Length Protein;
CAT#: BLC-02231P

Online Inquiry
Greater than 90% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Acyl-Coa-Binding Protein (ACB1) Protein (His)
  • Molecule: ACB1;
  • Species: Yeast;
  • Expression system: Yeast;
  • Tag: His;
  • Sequence: Full Length Protein;
CAT#: BLC-08185P

Online Inquiry
Greater than 90% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 μg/ml can bind human PEX19, the EC 50 of human PEX19 is 22.96-33.00 μg/ml.
Recombinant Human Atp-Binding Cassette Sub-Family D Member 1 (ABCD1) Protein (His), Active
  • Molecule: ABCD1;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: His;
  • Sequence: Full Length Protein;
CAT#: BLC-05645P

Online Inquiry
Greater than 85% as determined by SDS-PAGE.
Recombinant Acinetobacter Baumannii Efflux Pump Membrane Transporter (HMPREF0010_00594) Protein (His)
  • Molecule: HMPREF0010_00594;
  • Species: Acinetobacter baumannii ;
  • Expression system: E.coli;
  • Tag: His;
  • Sequence: Full Length Protein;
CAT#: BLC-00395P

Online Inquiry
Greater than 90% as determined by SDS-PAGE.
Recombinant Ctenocephalides Felis Salivary Antigen 1 Protein (His-SUMO)
  • Molecule: Salivary Antigen 1;
  • Species: Ctenocephalides felis ;
  • Expression system: E.coli;
  • Tag: His-SUMO;
  • Sequence: Full Length Protein;
CAT#: BLC-08547P

Online Inquiry
Greater than 90% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized OMA1 at 5 μg/ml can bind human BZW2, the EC 50 of human BZM2 is 45.42-72.22 μg/ml.
Recombinant Human Metalloendopeptidase Oma1, Mitochondrial (OMA1) Protein (His-SUMO), Active
  • Molecule: OMA1;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: His-SUMO;
  • Sequence: Full Length Protein;
CAT#: BLC-05648P

Online Inquiry
Recently viewed