Recombinant Human Aquaporin 7 / AQP7 Protein
Beta LifeScience
SKU/CAT #: BLA-12192P
Recombinant Human Aquaporin 7 / AQP7 Protein
Beta LifeScience
SKU/CAT #: BLA-12192P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | AQP 7 AQP 7L AQP 9 AQP-7 Aqp7 AQP7_HUMAN AQP7L AQP9 AQPap Aquaglyceroporin-7 Aquaporin 7 like Aquaporin adipose Aquaporin-7 Aquaporin-7-like Aquaporin7 MGC149555 MGC149556 |
Description | Recombinant Human Aquaporin 7 / AQP7 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MVQASGHRRSTRGSKMVSWSVIAKIQEILQRKMVREFLAEFMSTYVMMVF GLGSVAHMVLNKKYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFA NCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILHFSGGQLMVTG PVATAGIFATYLPDHMTLWRGFLNEAWLTGMLQLCLFAITDQENNPALPG TEALVIGILVVIIGVSLGMNTGYAINPSRDLPPRIFTFIAGWGKQVFSNG ENWWWVPVVAPLLGAYLGGIIYLVFIGSTIPREPLKLEDSVAYEDHGITV LPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMALEHF |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |