Recombinant Human Aquaporin 2 / AQP2 Protein
Beta LifeScience
SKU/CAT #: BLA-12190P
Recombinant Human Aquaporin 2 / AQP2 Protein
Beta LifeScience
SKU/CAT #: BLA-12190P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P41181 |
Synonym | ADH water channel AQP 2 AQP CD AQP-2 AQP-CD AQP2 AQP2_HUMAN AQPCD Aquaporin 2 collecting duct Aquaporin CD Aquaporin-2 Aquaporin-CD Aquaporin2 Aquaporine 2 Collecting duct water channel protein MGC34501 Water channel aquaporin 2 Water channel protein for renal collecting duct WCH CD WCH-CD WCHCD |
Description | Recombinant Human Aquaporin 2 / AQP2 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGL GIGTLVQALGHISGAHINPAVTVACLVGCHVSVLRAAFYVAAQLLGAVAG AALLHEITPADIRGDLAVNALSNSTTAGQAVTVELFLTLQLVLCIFASTD ERRGENPGTPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKFDD HWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGLEPDTDWEERE VRRRQSVELHSPQSLPRGTKA |
Molecular Weight | 55 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |