Recombinant Human APT2 Protein
Beta LifeScience
SKU/CAT #: BLA-12188P
Recombinant Human APT2 Protein
Beta LifeScience
SKU/CAT #: BLA-12188P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O95372 |
Synonym | Acyl protein thioesterase Acyl protein thioesterase 2 Acyl-protein thioesterase 2 APT 2 APT-2 APT2 DJ886K2.4 EC 3.1.2.- LPL I LPL II LPL-II LYPA2_HUMAN LYPLA 2 Lypla2 Lysophospholipase II LysoPLA II OTTHUMP00000002999 OTTHUMP00000044831 |
Description | Recombinant Human APT2 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMCGNTMSVPLLTDAATVSGAERETAAVIFL HGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMG LSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLY TALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPP V |
Molecular Weight | 27 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |