Recombinant Human APG5L/ATG5 Protein
Beta LifeScience
SKU/CAT #: BLA-12179P
Recombinant Human APG5L/ATG5 Protein
Beta LifeScience
SKU/CAT #: BLA-12179P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9H1Y0 |
Synonym | APG 5 APG 5L APG5 APG5 autophagy 5 like APG5 like APG5-like APG5L Apoptosis specific protein Apoptosis-specific protein ASP ATG 5 Atg5 ATG5 autophagy related 5 homolog ATG5_HUMAN Autophagy protein 5 Autophagy related 5 hAPG5 Homolog of S Cerevisiae autophagy 5 OTTHUMP00000040507 |
Description | Recombinant Human APG5L/ATG5 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMTDDKDVLRDVWFGRIPTCFTLYQDEITER EAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWFEYEGTPLKWH YPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMK EADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEEN GFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPE DGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD |
Molecular Weight | 35 kDa including tags |
Purity | Greater than 85% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |