Recombinant Human Apc1 Protein
Beta LifeScience
SKU/CAT #: BLA-12176P
Recombinant Human Apc1 Protein
Beta LifeScience
SKU/CAT #: BLA-12176P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | ANAPC 1 Anapc1 Anaphase promoting complex subunit 1 anaphase-promoting complex 1 (meiotic checkpoint regulator) Anaphase-promoting complex subunit 1 Apc 1 APC1 APC1_HUMAN Cyclosome subunit 1 MCPR Meiotic checkpoint regulator Mitotic checkpoint regulator Protein Tsg 24 Protein Tsg24 Testis-specific gene 24 protein TSG 24 TSG24 |
Description | Recombinant Human Apc1 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | NSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLV YHSVPAPQHLPPIGLEGSTSFAELLFKFKQLKMPVRALLRLAPLLLGNPQ PMVM |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |