Recombinant Human ANKRD54 Protein
Beta LifeScience
SKU/CAT #: BLA-12160P
Recombinant Human ANKRD54 Protein
Beta LifeScience
SKU/CAT #: BLA-12160P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q6NXT1 |
Synonym | Ankrd54 ankyrin repeat domain 54 Ankyrin repeat domain-containing protein 54 ANR54_HUMAN LIAR OTTHUMP00000198182 OTTHUMP00000198183 OTTHUMP00000198184 OTTHUMP00000198186 |
Description | Recombinant Human ANKRD54 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MAAAAGDADDEPRSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGG AGLSGRASGGAQSPLRYLHVLWQQDAEPRDELRCKIPAGRLRRAARPHRR LGPTGKEVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFA SCNGNDQIVQLLLDHGADPNQRDGLGNTPLHLAACTNHVPVITTLLRGGA RVDALDRAGRTPLHLAKSKLNILQEGHAQCLEAVRLEVKQIIHMLREYLE RLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR |
Molecular Weight | 35 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |