Recombinant Human ANKRA2 Protein
Beta LifeScience
SKU/CAT #: BLA-12156P
Recombinant Human ANKRA2 Protein
Beta LifeScience
SKU/CAT #: BLA-12156P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9H9E1 |
Synonym | ANKRA ANKRA 2 ANKRA2 Ankyrin repeat family A (RFXANK like) 2 Ankyrin repeat family A 2 Ankyrin repeat family A protein 2 Ankyrin repeat-containing protein, family A, member 2 ANRA2_HUMAN C11 C11 - RNP3 hRPC11 My010 OTTHUMP00000128195 RFXANK like 2 RFXANK-like protein 2 RPC10 RPC11 RPC12.5 |
Description | Recombinant Human ANKRA2 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMDTSTNLDIGAQLIVEECPSTYSLTGM PDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRFDMNVCSRFVKSLNEEDS KNIQDQVNSDLEVASVLFKAECNIHTSPSPGIQVRHVYTPSTTKHFSPIK QSTTLTNKHRGNEVSTTPLLANSLSVHQLAAQGEMLYLATRIEQENVINH TDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGY TDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIE TDSGYNSMDLAVALGYRSVQQVIESHLLKLLQNIKE |
Molecular Weight | 37 kDa including tags |
Purity | Greater than 85% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |