Recombinant Human AMID Protein
Beta LifeScience
SKU/CAT #: BLA-12126P
Recombinant Human AMID Protein
Beta LifeScience
SKU/CAT #: BLA-12126P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 5430437E11Rik aifm2 AIFM2_HUMAN AMID Apoptosis inducing factor (AIF) homologous mitochondrion associated inducer of death Apoptosis inducing factor (AIF) like mitochondrion associated inducer of death Apoptosis inducing factor mitochondrion associated 2 Apoptosis-inducing factor 2 Apoptosis-inducing factor homologous mitochondrion-associated inducer of death Apoptosis-inducing factor-like mitochondrion-associated inducer of death Cys51Stop HGNC11998 p53 responsive gene 3 p53 tumor suppressor p53-responsive gene 3 protein PRG3 TRP53 Tumor protein p53 |
Description | Recombinant Human AMID Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNV AALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEAL PFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGG GSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKG VQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSS AYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGL HANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVG |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |