Recombinant Human AMF Protein
Beta LifeScience
SKU/CAT #: BLA-12122P
Recombinant Human AMF Protein
Beta LifeScience
SKU/CAT #: BLA-12122P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P06744 |
Synonym | AMF Aurocrine motility factor Autocrine motility factor DKFZp686C13233 EC 5.3.1.9 G6PI_HUMAN Glucose phosphate isomerase Glucose-6-phosphate isomerase GNPI GPI Gpi1 Hexose monophosphate isomerase Hexosephosphate isomerase Neuroleukin NLK Oxoisomerase PGI PHI Phosphoglucose isomerase Phosphohexomutase Phosphohexose isomerase Phosphosaccharomutase SA 36 SA-36 SA36 Sperm antigen 36 |
Description | Recombinant Human AMF Proteinwas expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMAALTRDPQFQKLQQWYREHRSELNLRRLF DANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAA RERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMK SFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPR VWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFL QAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAI GLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINC FGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVW GEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFL AQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFT KLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELD GSAQVTSHDASTNGLINFIKQQREARVQ |
Molecular Weight | 62 kDa including tags |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Specific activity is > 400 units/mg obtained by measuring the increase of NADPH in absorbance at 340 nm resulting from the reduction of NADP. One unit will convert 1.0 umole of D-Fructose 6-phosphate to D-glucose 6-phosphate per minute at pH 7.4 at 37C. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | In the cytoplasm, catalyzes the conversion of glucose-6-phosphate to fructose-6-phosphate, the second step in glycolysis, and the reverse reaction during gluconeogenesis. Besides it's role as a glycolytic enzyme, also acts as a secreted cytokine: acts as an angiogenic factor (AMF) that stimulates endothelial cell motility. Acts as a neurotrophic factor, neuroleukin, for spinal and sensory neurons. It is secreted by lectin-stimulated T-cells and induces immunoglobulin secretion. |
Subcellular Location | Cytoplasm. Secreted. |
Protein Families | GPI family |
Database References | |
Associated Diseases | Hemolytic anemia, non-spherocytic, due to glucose phosphate isomerase deficiency (HA-GPID) |
Gene Functions References
- Study demonstrated a novel pathway regulating hypoxia-induced angiogenesis in rheumatoid arthritis mediated by glucose-6-phosphate isomerase. PMID: 28067317
- Our data suggest that glucose-6-phosphate isomerase gene polymorphism may serve as potential biomarkers to predict the overall survival of hepatocellular carcinoma. PMID: 27288297
- Mutation p.Gln413Arg fs*24 is the first frameshift null mutation to be described in GPI deficiency. Molecular modeling suggests that the structural change induced by the p.Gly87Ala pathogenic variant has direct impact in the structural arrangement of the region close to the active site of the enzyme. PMID: 27519939
- The 2 cysteines in hGPIc-c are prone to form disulfides upon oxidation. hGPIc-c could induce arthritis in both B10.Q and B10Q.Ncf1*/* mice, whereas hGPIs-s immunization did not induce disease at all, showing that these disulfides are critical for the arthritis-inducing immune response. The cysteines at position 330 and 333 are not crucial for TCR recognition. GILT expression affects hGPI-c-c processing at the CXXC motif. PMID: 29127146
- These results suggested that E4P by directly interacting with extracellular HPI/AMF may be an effective strategy to deter BCSC growth and progression. PMID: 28648642
- The silencing of PGI/AMF decreased the levels of phosphorylated Akt (-71.9%, P<0.001) compared with the scrambled siRNA, as well as the levels of the stemness marker, SOX2 (-61.7%, P<0.01). Taken together, these findings suggest that PGI/AMF silencing decreases migration, tumorsphere formation as well as the proportion of on the side population cells in glioblastoma U87 cells. PMID: 26936801
- NLK is able to promote cell proliferation and type II collagen synthesis during in vitro chondrocyte propagation. PMID: 26573126
- Suggest tha AMF/PGI-mediated tumorigenesis occurs through MAPK-ERK signaling in endometrial carcinoma. PMID: 26308071
- Study supports a role for AMF mediating epithelial-mesenchymal transition in endometrial cancer (EC) through MAPK signaling. Therefore, AMF may provide a potential prognostic and therapeutic target in preventing EC progression. PMID: 26201353
- Results showed an increase in GPI and AMFR in clear cell-renal cell carcinoma cells, and their colocalization on plasma membrane. Kaplan-Meier curves showed significant differences in survival among groups of patients with high versus low GPI. PMID: 26579829
- The association of ENO1 and GPI with postthaw sperm viability and motility was confirmed using Pearson's linear correlation. ENO1 and GPI can be used as markers of human sperm freezability before starting the cryopreservation procedure. PMID: 25910678
- High GPI expression is associated with metastatic phenotype of breast cancer. PMID: 24440856
- PGI is a moonlighting protein that functions as a cytosolic enzyme involved in glycolysis and gluconeogenesis, and as cytokine through binding to its cell surface receptor. PMID: 11004567
- Serum anti-GPI autoantibodies are useful for the diagnosis of rheumatoid arthritis in Chinese patients. PMID: 23773638
- Findings suggest that autocrine motility factor (AMF)-HER2 interaction might be a novel target for therapeutic management of patients with breast cancer, whose disease is resistant to trastuzumab. PMID: 23248119
- For PGI, an extended active site in which residues in the first, second, and third layers around the reacting substrate are predicted. PMID: 21970785
- GPI is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells. PMID: 21555518
- By regulating ER calcium release, AMF/PGI interaction with gp78/AMFR therefore protects against ER stress identifying novel roles for these cancer-associated proteins in promoting tumor cell survival. PMID: 21252914
- Data suggest that elevated serum glucose-6-phosphate isomerase may be involved in the synovitis of rheumatoid arthritis and may prove useful as a serum marker for disease activity. PMID: 20810510
- Data show that effective downregulation of AMF/PGI expression and subsequent abrogation of AMF/PGI secretion, which resulted in morphologic change with reduced growth, motility, and invasion. PMID: 20978190
- autocrine motility factor/phosphoglucose isomerase against TGF-beta-induced apoptosis was correlated with its enzymatic activity PMID: 19819066
- hypoxia-induced gene in pancreatic cancer cell lines PMID: 11688991
- Overexpression induces neoplastic transformation and survival of NIH-3T3 fibroblasts. PMID: 12517804
- The results demonstrate that the enzymatic activity of PGI is not essential for either receptor binding or cytokine function of human PGI. PMID: 12527360
- crystal structure and analysis of the initial ring-opening step of catalysis PMID: 12573240
- role in regulating cell proliferation PMID: 12783864
- AMF regulates expression of Apaf-1 and caspase-9 genes via a complex signaling pathway and indirectly regulates formation of the apoptosome. (autocrine motility factor) PMID: 14566819
- The observations are consistent with a downstream mediation role of MMP-3 in Pohophoglucose isomerase/AMF-stimulated tumor cell metastasis. PMID: 14715248
- T-cell dependent peripheral polyarthritis induced by recombinant human glucose-6-phosphate isomerase in genetically unaltered mice demonstrates for the first time the induction of organ-specific disease by systemic autoimmunity. PMID: 15034067
- In addition to the findings in rheumatoid arthritis, our results indicate that GPI is not a general target of autoantibodies in juvenile idiopathic arthritis. PMID: 15290745
- Our results suggest that GPI variants may play a crucial role in the production of autoantibodies against ubiquitous GPI autoantigens. PMID: 15369782
- AMF expression significantly contributes to the aggressive phenotype of pancreatic cancer PMID: 15570012
- phosphoglucose isomerase/autocrine motility factor activities are differentially regulated by protein kinase CK2 phosphorylation PMID: 15637053
- interaction with hypoxia-inducible factor-1 drives mobility of erythroid progenitor cells PMID: 15850830
- N-glyco side-chain of AMFR is a trigger and that interaction between the 117-C-terminal part of AMF and the extracellular core protein of autocrine motility factor receptor (AMFR) is needed during AMF-AMFR interactions PMID: 16563432
- elevated G6PI levels present in patients with immune-based inflammatory arthritis may contribute to elevated levels of anti-G6PI Abs and G6PI/anti-G6PI immune complexes PMID: 16949042
- Missense mutations c.341A>T (p.Asp113Val) in exon 4 and c.663T>G (p.Asn220Lys) in exon 7 are associated with hereditary nonspherocytic hemolytic anemia. PMID: 17041899
- the receptor molecule for AMF/NLK/MF in leukemic differentiation is not gp78 PMID: 17071500
- raft-dependent endocytosis of AMF follows a distinct phosphatidylinositol 3-kinase-dependent pathway that is up-regulated in more aggressive tumor cells PMID: 17690101
- PGI/AMF is involved in oxidative stress-induced cellular senescence and should bring novel insights into the control of cellular growth leading to a new methodology for cancer treatment. PMID: 17925402
- IL-6 and Th17 play an essential role in GPI-induced arthritis PMID: 18311788
- Results of this study suggest that AMF stimulation stimulates MMP3 expression via a MAPK signaling pathway. PMID: 18485900
- Peptide fragment glucose phosphate isomerase (GPI)325-339 is identified as a major epitope in GPI-induced arthritis, with potential to induce polyarthritis. PMID: 18992137
- Mutations effect catalytic activity and structural stability of human glucose-6-phosphate isomerase. PMID: 19064002
- Expression of this protein leads to mesenchymal-topepithelial transition in breast cancer cells. PMID: 19531650
- overexpression of PGI significantly contributes to the aggressive phenotype of human colon cancer PMID: 19787266
- melanoma migration induced by AMF is mediated by autocrine production of IL-8 as a novel downstream modulator of the AMF signaling pathway PMID: 19801670