Recombinant Human ALPK1 Protein
Beta LifeScience
SKU/CAT #: BLA-12114P
Recombinant Human ALPK1 Protein
Beta LifeScience
SKU/CAT #: BLA-12114P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 8430410J10Rik Alpha protein kinase 1 Alpha-protein kinase 1 ALPK1 ALPK1_HUMAN Chromosome 4 kinase LAK Lymphocyte alpha kinase Lymphocyte alpha protein kinase Lymphocyte alpha-protein kinase RGD1304613 |
Description | Recombinant Human ALPK1 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | VVKTEYKATEYGLAYGHFSYEFSNHRDVVVDLQGWVTGNGKGLIYLTDPQ IHSVDQKVFTTNFGKRGIFYFFNNQHVECNEICHRLSLTRPSMEKP |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |