Recombinant Human Alpha SNAP Protein
Beta LifeScience
SKU/CAT #: BLA-12112P
Recombinant Human Alpha SNAP Protein
Beta LifeScience
SKU/CAT #: BLA-12112P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P54920 |
Synonym | Alpha soluble NSF attachment protein Alpha-soluble NSF attachment protein N ethylmaleimide sensitive factor attachment protein alpha N-ethylmaleimide-sensitive factor attachment protein alpha napA NSF attachment protein alpha SNAA_HUMAN SNAP alpha SNAP-alpha SNAPA |
Description | Recombinant Human Alpha SNAP Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMDNSGKEAEAMALLAEAERKVKNSQSFFSG LFGGSSKIEEACEIYARAANMFKMAKNWSAAGNAFCQAAQLHLQLQSKHD AATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEI YETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQK AIDIYEQVGTNAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEE LFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTML LRIKKTIQGDEEDLR |
Molecular Weight | 35 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |