Recombinant Human alpha Defensin 5/DEFA5 Protein
Beta LifeScience
SKU/CAT #: BLA-12107P
Recombinant Human alpha Defensin 5/DEFA5 Protein
Beta LifeScience
SKU/CAT #: BLA-12107P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q01523 |
Synonym | alpha 5 DEF5 DEF5_HUMAN Defa Defa29 DEFA5 Defcr29 Defcr5 Defensin Defensin 5 Defensin alpha 5 Defensin alpha 5 Paneth cell specific Defensin alpha 5 preproprotein Enteric defensin HD 5 HD5 HD5(20-94) HD5(63-94) MGC129728 RD 5 |
Description | Recombinant Human alpha Defensin 5/DEFA5 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNG LSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |