Recombinant Human alpha COP1 / COPA Protein
Beta LifeScience
SKU/CAT #: BLA-12103P
Recombinant Human alpha COP1 / COPA Protein
Beta LifeScience
SKU/CAT #: BLA-12103P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P53621 |
Synonym | Alpha coat protein Alpha COP Alpha COPI Alpha-coat protein Alpha-COP AlphaCOP Coatomer protein complex subunit alpha Coatomer subunit alpha COP A COP I alpha copA COPA_HUMAN COPI alpha FLJ26320 HEP COP HEP-COP HEPCOP Proxenin Xenin Xenopsin-related peptide |
Description | Recombinant Human alpha COP1 / COPA Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | TKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDG PVRGIDFHKQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTF |
Molecular Weight | 37 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |