Recombinant Human alpha Actinin/ACTN1 Protein
Beta LifeScience
SKU/CAT #: BLA-12100P
Recombinant Human alpha Actinin/ACTN1 Protein
Beta LifeScience
SKU/CAT #: BLA-12100P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P12814-3 |
Synonym | actinin 1 smooth muscle Actinin alpha 1 actinin, alpha 1 ACTN 1 Actn1 ACTN1_HUMAN Alpha Actinin 1 Alpha actinin cytoskeletal isoform Alpha-actinin cytoskeletal isoform Alpha-actinin-1 BDPLT15 F actin cross linking protein F-actin cross-linking protein FLJ40884 FLJ54432 Non muscle alpha actinin 1 Non-muscle alpha-actinin-1 |
Description | Recombinant Human alpha Actinin/ACTN1 Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSEFMDHYDSQQTNDYMQPEEDWDRDLLL DPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGE RLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLG MIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKD GLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAE DIVGTARPDEKAIMTYVSSFYHAF |
Molecular Weight | 31 kDa including tags |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |