Recombinant Human alpha 1,2 Mannosidase IA/MAN1A1 Protein
Beta LifeScience
SKU/CAT #: BLA-12094P
Recombinant Human alpha 1,2 Mannosidase IA/MAN1A1 Protein
Beta LifeScience
SKU/CAT #: BLA-12094P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P33908 |
Synonym | 2-alpha-mannosidase IA 2-mannosidase IA Alpha 1,2 mannosidase IA Alpha-1 EC 3.2.1.113 HUMM3 HUMM9 MA1A1_HUMAN Man(9) alpha mannosidase Man(9)-alpha-mannosidase MAN1A1 MAN9 Man9 mannosidase Man9-mannosidase Mannosidase alpha class 1A member 1 Mannosyl-oligosaccharide 1 Mannosyl-oligosaccharide 1,2 alpha mannosidase IA OTTHUMP00000017107 Processing alpha 1,2 mannosidase IA Processing alpha-1 |
Description | Recombinant Human alpha 1,2 Mannosidase IA/MAN1A1 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | PGDPEAALEDNLARIRENHERALREAKETLQKLPEEIQRDILLEKKKVAQ DQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREKRAKI |
Molecular Weight | 36 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |