Recombinant GST-TRK fused gene-ALK fusion Protein
Beta LifeScience
SKU/CAT #: BLA-7957P
Recombinant GST-TRK fused gene-ALK fusion Protein
Beta LifeScience
SKU/CAT #: BLA-7957P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q92734Q9UM73 |
Description | Recombinant GST-TRK fused gene-ALK fusion Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLS NDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESS QVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPEN |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The specific activity of this protein was 22 nmol/min/mg in a kinase assay using IGF1Rtide synthetic peptide substrate. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |