Recombinant Fe/S biogenesis Protein NfuA (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3781P
Recombinant Fe/S biogenesis Protein NfuA (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3781P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Vibrio vulnificus |
Accession | Q8DDU2 |
Description | Recombinant Fe/S biogenesis Protein NfuA (Tagged) was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEA VEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKM RKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGG CNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY |
Purity | >90% by SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. |
Protein Families | NfuA family |
Database References | KEGG: vvu:VV1_0864 |