Recombinant Fe/S biogenesis Protein NfuA (Tagged)

Beta LifeScience SKU/CAT #: BLA-3781P
Recombinant Fe/S biogenesis Protein NfuA (Tagged)

Recombinant Fe/S biogenesis Protein NfuA (Tagged)

Beta LifeScience SKU/CAT #: BLA-3781P
Catalog No.: BLA-3781P

Product Overview

Host Species Vibrio vulnificus
Accession Q8DDU2
Description Recombinant Fe/S biogenesis Protein NfuA (Tagged) was expressed in Mammalian. It is a Full length protein
Source Mammalian
AA Sequence MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEA VEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKM RKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGG CNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY
Purity >90% by SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed