Recombinant EndoProteinase Arg-C
Beta LifeScience
SKU/CAT #: BLA-3774P
Recombinant EndoProteinase Arg-C
Beta LifeScience
SKU/CAT #: BLA-3774P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Accession | O87544 |
Description | Recombinant EndoProteinase Arg-C was expressed in Insect cells. It is a Protein fragment |
Source | Insect cells |
AA Sequence | GVGDIGSSDYCEKDIVCRVKPSAEFLSASKSVARMVFTPKTGYTGYCSGT LLNNSNSPKRQLFWSAAHCISTQKVANTLQTYWLYDATGCDNDTLSDKAV TLTGGATLLHSHATRDTLLLELKSAPPSGAYYAGWNSSAIATKGTAIEGI HHPSGDLKKYSLGSVTALSSTIDGKKPLTKVAWTTGVTEGGSSGSGLFTI SSTSGYQLRGGLYGGTSYCSAPSDPDYYSQLDGVWSSIKTYFSPHHHHHH HH |
Molecular Weight | 27 kDa including tags |
Purity | >98% SDS-PAGE.>98% by HPLC. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The reaction is measured as an increase in absorbance at 253 nm resulting from the hydrolysis of N-benzoyl-L-arginine ethyl ester (BAEE). |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |