Recombinant EndoProteinase Arg-C

Beta LifeScience SKU/CAT #: BLA-3774P
Recombinant EndoProteinase Arg-C

Recombinant EndoProteinase Arg-C

Beta LifeScience SKU/CAT #: BLA-3774P
Catalog No.: BLA-3774P

Product Overview

Accession O87544
Description Recombinant EndoProteinase Arg-C was expressed in Insect cells. It is a Protein fragment
Source Insect cells
AA Sequence GVGDIGSSDYCEKDIVCRVKPSAEFLSASKSVARMVFTPKTGYTGYCSGT LLNNSNSPKRQLFWSAAHCISTQKVANTLQTYWLYDATGCDNDTLSDKAV TLTGGATLLHSHATRDTLLLELKSAPPSGAYYAGWNSSAIATKGTAIEGI HHPSGDLKKYSLGSVTALSSTIDGKKPLTKVAWTTGVTEGGSSGSGLFTI SSTSGYQLRGGLYGGTSYCSAPSDPDYYSQLDGVWSSIKTYFSPHHHHHH HH
Molecular Weight 27 kDa including tags
Purity >98% SDS-PAGE.>98% by HPLC.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity The reaction is measured as an increase in absorbance at 253 nm resulting from the hydrolysis of N-benzoyl-L-arginine ethyl ester (BAEE).
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed