Recombinant E. coli RuvC Protein

Beta LifeScience SKU/CAT #: BLA-3742P
Recombinant E. coli  RuvC Protein

Recombinant E. coli RuvC Protein

Beta LifeScience SKU/CAT #: BLA-3742P
Catalog No.: BLA-3742P

Product Overview

Host Species Escherichia coli
Accession P0A814
Synonym Crossover junction endodeoxyribonuclease ruvC Holliday junction nuclease ruvC Holliday junction resolvase ruvC
Description Recombinant E. coli RuvC Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MAIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDD LPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIV AAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADA ADALAIAITHCHVSQNAMQMSESRLNLARGRLR
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Stable for 12 months at -20°C.
Recently viewed