Recombinant E. coli ppa Protein

Beta LifeScience SKU/CAT #: BLA-3730P
Recombinant E. coli  ppa Protein

Recombinant E. coli ppa Protein

Beta LifeScience SKU/CAT #: BLA-3730P
Catalog No.: BLA-3730P

Product Overview

Host Species Escherichia coli
Accession P0A7A9
Synonym ECK4222 Inorganic pyrophosphatase IPYR_ECOLI JW4185 ppa PPase Pyrophosphate phospho-hydrolase
Description Recombinant E. coli ppa Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMSLLNVPAGKDLPEDIYVVIEIPANADPIK YEIDKESGALFVDRFMSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPL QPGSVIRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDHIKDVNDLPEL LKAQIAHFFEHYKDLEKGKWVKVEGWENAEAAKAEIVASFERAKNK
Molecular Weight 22 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle.
Recently viewed