Recombinant E. coli Hygromycin B kinase Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3699P
Recombinant E. coli Hygromycin B kinase Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3699P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Escherichia coli |
Accession | P00557 |
Description | Recombinant E. coli Hygromycin B kinase Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRGYVLRV NSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTL QDLPETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDF ICAIADPHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFG SNNVLTDNGRITAVIDWSEAMFGDSQYEVANIFFWRPWLACMEQQTRYFE RRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSG AGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAKE |
Molecular Weight | 54 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | The aminoglycoside phosphotransferases achieve inactivation of their antibiotic substrates by phosphorylation. Only phosphorylates hygromycin and closely related compounds such as demethyl analogs and destomycin. |
Protein Families | Aminoglycoside phosphotransferase family |
Database References | KEGG: ag:CAA24743 |