Recombinant E. coli gor Protein

Beta LifeScience SKU/CAT #: BLA-3687P
Recombinant E. coli  gor Protein

Recombinant E. coli gor Protein

Beta LifeScience SKU/CAT #: BLA-3687P
Catalog No.: BLA-3687P

Product Overview

Host Species Escherichia coli
Accession P06715
Synonym ECK3485 glutathione oxidoreductase Glutathione reductase gor gorA GR GRase GSHR_ECOLI JW3467
Description Recombinant E. coli gor Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSMTKHYDYIAIGGGSGGIASINRAAMYG QKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHMYGPDYGFDTTIN KFNWETLIASRTAYIDRIHTSYENVLGKNNVDVIKGFARFVDAKTLEVNG ETITADHILIATGGRPSHPDIPGVEYGIDSDGFFALPALPERVAVVGAGY IAVELAGVINGLGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHT NAIPKAVVKNTDGSLTLELEDGRSETVDCLIWAIGREPANDNINLEAAGV KTNEKGYIVVDKYQNTNIEGIYAVGDNTGAVELTPVAVAAGRRLSERLFN NKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDDQVKVYKSSFTA MYTAVTTHRQPCRMKLVCVGSEEKIVGIHGIGFGMDEMLQGFAVALKMGA TKKDFDNTVAIHPTAAEEFVTMR
Molecular Weight 51 kDa including tags
Purity Greater than 90% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed