Recombinant E. coli DnaK Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-3662P
Recombinant E. coli  DnaK Protein (His tag)

Recombinant E. coli DnaK Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-3662P
Catalog No.: BLA-3662P

Product Overview

Host Species Escherichia coli
Accession Q1RGI8
Synonym Chaperone Hsp70 Chaperone protein dnaK Co chaperone with DnaJ dnaK Heat shock 70 kDa protein HSP70
Description Recombinant E. coli DnaK Protein (His tag) was expressed in Yeast. It is a Full length protein
Source Yeast
AA Sequence MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLV GQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGD AWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQ RQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGTF DISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGI DLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKV TRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQ KKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLG IETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAAD NKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKIT IKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQV EEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLME IAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVKDKK
Molecular Weight 71 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed