Recombinant E. coli Acetate Kinase Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-3637P
Recombinant E. coli  Acetate Kinase Protein (His tag)

Recombinant E. coli Acetate Kinase Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-3637P
Catalog No.: BLA-3637P

Product Overview

Host Species Escherichia coli
Accession P0A6A3
Synonym acetate kinase A and propionate kinase 2 Acetokinase ack EC=2.7.2.1
Description Recombinant E. coli Acetate Kinase Protein (His tag) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MSSKLVLVLNCGSSSLKFAIIDAVNGEEYLSGLAECFHLPEARIKWKMDG NKQEAALGAGAAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYT SSVVIDESVIQGIKDAASFAPLHNPAHLIGIEEALKSFPQLKDKNVAVFD TAFHQTMPEESYLYALPYNLYKEHGIRRYGAHGTSHFYVTQEAAKMLNKP VEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVMGTRSGDIDPA IIFHLHDTLGMSVDAINKLLTKESGLLGLTEVTSDCRYVEDNYATKEDAK RAMDVYCHRLAKYIGAYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLG VLGFEVDHERNLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed