Recombinant cynomolgus monkey Folate Binding Protein/FBP Protein

Beta LifeScience SKU/CAT #: BLA-3595P
Recombinant cynomolgus monkey Folate Binding Protein/FBP Protein

Recombinant cynomolgus monkey Folate Binding Protein/FBP Protein

Beta LifeScience SKU/CAT #: BLA-3595P
Catalog No.: BLA-3595P

Product Overview

Host Species Cynomolgus monkey
Accession F7BP60
Synonym adult Adult folate binding protein Adult folate-binding protein FBP Folate Binding Protein Folate receptor Folate receptor 1 Folate Receptor 1 Adult Folate Receptor 1 Precursor Folate receptor adult Folate receptor alpha FOLR FOLR1 FOLR1_HUMAN FR alpha FR-alpha FRalpha KB cells FBP MOV18 Ovarian cancer associated antigen Ovarian tumor associated antigen Ovarian tumor associated antigen MOv18 Ovarian tumor-associated antigen MOv18
Description Recombinant cynomolgus monkey Folate Binding Protein/FBP Proteinwas expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence RTARARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWKKNACCSTNTSQEA HKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSW RKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCPVGAA CQPFHFYFPTPTVLCNEIWTYSYKVSNYSRGSGRCIQMWFDPAQGNPNEE VARFYAAAM
Molecular Weight 26 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Immobilized Folic acid-BSA conjugate at 20 μg/mL (100 μL/well) can bind this protein with a linear range of 0.156-2.5 μg/mL.
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed