Recombinant Cow Pentraxin 3/PTX3 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-3575P
Recombinant Cow Pentraxin 3/PTX3 Protein (Tagged)

Recombinant Cow Pentraxin 3/PTX3 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-3575P
Catalog No.: BLA-3575P

Product Overview

Host Species Cow
Accession Q0VCG9
Synonym AI607804 Pentaxin 3 Pentaxin-related protein PTX3 Pentraxin 3 long Pentraxin-related gene Pentraxin-related gene rapidly induced by IL-1 beta Pentraxin-related protein PTX3 PTX3 PTX3_HUMAN TNF alpha-induced protein 5 TNFAIP5 TSG-14 TSG14 Tumor necrosis factor alpha-induced protein 5 Tumor necrosis factor-inducible gene 14 protein Tumor necrosis factor-inducible protein TSG-14
Description Recombinant Cow Pentraxin 3/PTX3 Protein (Tagged) was expressed in Mammalian. It is a Full length protein
Source Mammalian
AA Sequence ENSDDYELMYVNLDNEIDNGLHPTEDPTPCDCSRENSEWDKLFTMLENSQ MREGMLLQATDVMLRGELQKLQAELGRLEGSLQKLCGPEAPSETRLARAL DDLLQASRDAGRRLARLEDAGALRPQEEAGRALGAVLEELRRTRADLRAV QGWAASRWLPAGCETAILFPMRSKKIFASVHPVTPMKLETFSACIWVKAT EVLNKTVLFSYGTKRNPYEIQLYLSYRSIMLVVGGEENRLVADAVISLGT WTHLCSTWDSKKGHMALWVNGDSVATAVDMATGHVVPEGGILQIGQEKNG CCVGGGFDETLAFSGRLTGFNIWEGVLSNEEIREAGGAESCHIRGNVVGW GVTEIQPHGGAQYVY
Molecular Weight 45 kDa including tags
Purity >90% by SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed