Recombinant Cat Allergen Fel d 4 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-3548P
Recombinant Cat Allergen Fel d 4 Protein (His tag)

Recombinant Cat Allergen Fel d 4 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-3548P
Catalog No.: BLA-3548P

Product Overview

Host Species Cat
Accession Q5VFH6
Description Recombinant Cat Allergen Fel d 4 Protein (His tag) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence HEEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEHIKALD NSSLSFVFHTKENGKCTEIFLVADKTKDGVYTVVYDGYNVFSIVETVYDE YILLHLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIVNILDL TEVDRCLQARGSEVAQDSSVE
Molecular Weight 20 kDa
Purity >85% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed