Recombinant C4 Protease Protein

Beta LifeScience SKU/CAT #: BLA-3546P
Recombinant C4 Protease Protein

Recombinant C4 Protease Protein

Beta LifeScience SKU/CAT #: BLA-3546P
Catalog No.: BLA-3546P

Product Overview

Host Species Tobacco vein mottling virus
Accession P09814
Description Recombinant C4 Protease Protein was expressed in Tobacco Vein Mottling Virus. It is a Full length protein
Source Tobacco Vein Mottling Virus
AA Sequence MASMTGGQQMGRGHHHHHHGNLYFQGGEFSKALLKGVRDFNPISACVWLL ENSSDGHSERLFGIGFGPYIIANQHLFRRNNGELTIKTMHGEFKVKNSTQ LQMKPVEGRDIIVIKMAKDFPPFPQKLKFRQPTIKDRVCMVSTNFQQKSV SSLVSESSHIVHKEDTSFWQHWITTKDGQCGSPLVSIIDGNILGIHSLTH TTNGSNYFVEFPEKFVATYLDAADGWCKNWKFNADKISWGSFTLVEDAPE DDFMAKKTVAAIMD
Molecular Weight 30 kDa including tags
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed