Recombinant BETVIII Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-3542P
Recombinant BETVIII Protein (Tagged)

Recombinant BETVIII Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-3542P
Catalog No.: BLA-3542P

Product Overview

Accession P43187
Description Recombinant BETVIII Protein (Tagged) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MPCSTEAMEKAGHGHASTPRKRSLSNSSFRLRSESLNTLRLRRIFDLFDK NSDGIITVDELSRALNLLGLETDLSELESTVKSFTREGNIGLQFEDFISL HQSLNDSYFAYGGEDEDDNEEDMRKSILSQEEADSFGGFKVFDEDGDGYI SARELQMVLGKLGFSEGSEIDRVEKMIVSVDSNRDGRVDFFEFKDMMRSV LVRSS
Molecular Weight 43 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed