Recombinant Beta-mammal toxin Css4 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-3541P
Recombinant Beta-mammal toxin Css4 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-3541P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Centruroides suffusus |
Accession | P60266 |
Description | Recombinant Beta-mammal toxin Css4 Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTH LYEQAVVWPLPNKTCN |
Molecular Weight | 24 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals. |
Subcellular Location | Secreted. |
Protein Families | Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily |
Tissue Specificity | Expressed by the venom gland. |