Recombinant Aculeacin-A acylase Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3517P
Recombinant Aculeacin-A acylase Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3517P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Accession | P29958 |
Description | Recombinant Aculeacin-A acylase Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | GGYAALIRRASYGVPHITADDFGSLGFGVGYVQAEDNICVIAESVVTANG ERSRWFGATGPDDADVRTTSSTQAIDDRVAERLLEGPRDGVRAPCDDVRD QMRGFVAGYNHFLRRTGVHRLTDPACRGKAWVRPLSEIDLWRTSWDSMVR AGSGALLDGIVAATPPTAAGPASAPEAPDA |
Molecular Weight | 35 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Catalyzes the hydrolysis of the palmitoyl moiety of the antifungal antibiotic, aculeacin-A, giving a hexapeptide moiety and a long chain fatty acid. |
Subcellular Location | Secreted. |
Protein Families | Peptidase S45 family |