Recombinant Aculeacin-A acylase Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-3517P
Recombinant Aculeacin-A acylase Protein (Tagged)

Recombinant Aculeacin-A acylase Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-3517P
Catalog No.: BLA-3517P

Product Overview

Accession P29958
Description Recombinant Aculeacin-A acylase Protein (Tagged) was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence GGYAALIRRASYGVPHITADDFGSLGFGVGYVQAEDNICVIAESVVTANG ERSRWFGATGPDDADVRTTSSTQAIDDRVAERLLEGPRDGVRAPCDDVRD QMRGFVAGYNHFLRRTGVHRLTDPACRGKAWVRPLSEIDLWRTSWDSMVR AGSGALLDGIVAATPPTAAGPASAPEAPDA
Molecular Weight 35 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed