Recombinant A. thaliana FLS1 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-3510P
Recombinant A. thaliana FLS1 Protein (Tagged)

Recombinant A. thaliana FLS1 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-3510P
Catalog No.: BLA-3510P

Product Overview

Host Species Arabidopsis thaliana
Accession Q96330
Description Recombinant A. thaliana FLS1 Protein (Tagged) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MEVERVQDISSSSLLTEAIPLEFIRSEKEQPAITTFRGPTPAIPVVDLSD PDEESVRRAVVKASEEWGLFQVVNHGIPTELIRRLQDVGRKFFELPSSEK ESVAKPEDSKDIEGYGTKLQKDPEGKKAWVDHLFHRIWPPSCVNYRFWPK NPPEYREVNEEYAVHVKKLSETLLGILSDGLGLKRDALKEGLGGEMAEYM MKINYYPPCPRPDLALGVPAHTDLSGITLLVPNEVPGLQVFKDDHWFDAE YIPSAVIVHIGDQILRLSNGRYKNVLHRTTVDKEKTRMSWPVFLEPPREK IVGPLPELTGDDNPPKFKPFAFKDYSYRKLNKLPLD
Molecular Weight 43 kDa including tags
Purity >85% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed