Recombinant A. thaliana FLS1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3510P
Recombinant A. thaliana FLS1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-3510P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Arabidopsis thaliana |
Accession | Q96330 |
Description | Recombinant A. thaliana FLS1 Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MEVERVQDISSSSLLTEAIPLEFIRSEKEQPAITTFRGPTPAIPVVDLSD PDEESVRRAVVKASEEWGLFQVVNHGIPTELIRRLQDVGRKFFELPSSEK ESVAKPEDSKDIEGYGTKLQKDPEGKKAWVDHLFHRIWPPSCVNYRFWPK NPPEYREVNEEYAVHVKKLSETLLGILSDGLGLKRDALKEGLGGEMAEYM MKINYYPPCPRPDLALGVPAHTDLSGITLLVPNEVPGLQVFKDDHWFDAE YIPSAVIVHIGDQILRLSNGRYKNVLHRTTVDKEKTRMSWPVFLEPPREK IVGPLPELTGDDNPPKFKPFAFKDYSYRKLNKLPLD |
Molecular Weight | 43 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Catalyzes the formation of flavonols from dihydroflavonols. It can act on dihydrokaempferol to produce kaempferol, on dihydroquercetin to produce quercitin and on dihydromyricetin to produce myricetin. In vitro catalyzes the oxidation of both enantiomers of naringenin to give both cis- and trans-dihydrokaempferol. |
Subcellular Location | Cytoplasm. Nucleus. |
Protein Families | Iron/ascorbate-dependent oxidoreductase family |
Database References | |
Tissue Specificity | Expressed in young seedlings (at protein level). Expressed in roots, emerging leaves, shoot-root transition zone, trichomes, flowers and siliques. In cotyledons, expressed mostly on the adaxial side and only in guard cells on the abaxial side. |
Gene Functions References
- double mutant plants that harbor fls1kknock out in the pap1-D background (i.e., pap1-D/fls1ko plants) were generated, to examine whether anthocyanins can be further enhanced by blocking flavonol biosynthesis under PAP1 overexpression. PMID: 27562381
- Overexpression of FLS1 (FLS1-OX) not only altered seed coat color (resulting in a light brown color), but also affected flavonoid accumulation. Whereas fls1-3 mutants accumulated higher anthocyanin levels, FLS1-OX seedlings had lower levels than those of the wild-type. PMID: 26990404